PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02966.2.p
Common NameEUGRSUZ_K02966, LOC104426365
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 367aa    MW: 41802.1 Da    PI: 6.9651
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02966.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-3175128255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtp+LH rF++a+e+LGG+++AtPk +l+lm++kgL+++hvkSHLQ+YR 
  Eucgr.K02966.2.p  75 PRLRWTPDLHLRFIHAIERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQMYRN 128
                       8****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.79171131IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2971129IPR009057Homeodomain-like
SuperFamilySSF466891.51E-1473129IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-2375130IPR006447Myb domain, plants
PfamPF002494.1E-976127IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MKEIEGESRT ECSEECQSSY QNKEEEEESD ENEDESKAAN GGSSSNSTVE EMSHDGRHHH  60
QKKPSVRPYV RSKMPRLRWT PDLHLRFIHA IERLGGQDRA TPKLVLQLMN IKGLSIAHVK  120
SHLQMYRNKK IDDNGQVLAD HRHLVECGEN NNVYKLSQLP MLQGYSGQTS NFRYGDPCWR  180
AGEYQMHNNP FSGWRSREET RPGLYGRVAE KLFGNKNGIW SNFLLGASSF NRQPNWTYQQ  240
EVKHPYISSR NQGTWKNIES RMSQIEHQRT AQLRAEGGEN GNFDKSIASE LKRKVDGRDI  300
DLNLSLQVNQ DYDEGHGSSE EANDVDSSLS LSLFSAKASK HRKLNDESKE IKEHGIGRAS  360
TLDLTL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02966.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037685.10.0PREDICTED: uncharacterized protein LOC104426365
TrEMBLA0A059A5U20.0A0A059A5U2_EUCGR; Uncharacterized protein
STRINGPOPTR_0016s12940.16e-83(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-60G2-like family protein